PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.4G050300.1.p
Common NamePRUPE_ppa007258mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family Dof
Protein Properties Length: 377aa    MW: 40988.8 Da    PI: 8.026
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.4G050300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.61.6e-3966126262
              zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                         +++alkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+++
  Prupe.4G050300.1.p  66 QQQALKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRVK 126
                         57899*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.1E-3368124IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.52570124IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-2671124IPR003851Zinc finger, Dof-type
PROSITE patternPS01361072108IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MLSNCDHEKM VLISSTTNEW PQMQQQDNIQ IDDHHQKGLN NNMSSSTSSP ATRIMEKPGQ  60
EQLQLQQQAL KCPRCDSSNT KFCYYNNYSL SQPRHFCKAC KRYWTRGGTL RNVPVGGGCR  120
KNKRVKRPGS SSSSAMDGAS SSSSSIPSNT ANNNNSNSNP PSQPSQIDQI NPMFYGLPSN  180
PFMDSPSSAS GFDLHQLNHH HAQLGLGFSS AGTFMSGDNY RNRFNPTSNS SLPSSNYSSI  240
FSTSPSTTTT TPTMASVLAS KFLNGGSFKD IQARGPNHNQ YFQSLLPFED LHIAAGNTGE  300
AGGAAKDVKV EDQAGQNRLE WNNNSNNNNV NGNMNCQNQM TEQMGLSDPS LYWSSTTLGA  360
NWHDPSNLGS SVSSLI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007211446.10.0hypothetical protein PRUPE_ppa007258mg
TrEMBLM5X0R00.0M5X0R0_PRUPE; Uncharacterized protein
STRINGVIT_10s0003g00040.t011e-79(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45223356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.22e-34Dof family protein